Lineage for d1x7qa1 (1x7q A:182-275)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1514415Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1514416Species Human (Homo sapiens) [TaxId:9606] [88605] (187 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1514420Domain d1x7qa1: 1x7q A:182-275 [121790]
    Other proteins in same PDB: d1x7qa2, d1x7qb_
    automatically matched to d1q94a1
    complexed with gol, so4

Details for d1x7qa1

PDB Entry: 1x7q (more details), 1.45 Å

PDB Description: Crystal structure of HLA-A*1101 with sars nucleocapsid peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-11 alpha chain

SCOPe Domain Sequences for d1x7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x7qa1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d1x7qa1:

Click to download the PDB-style file with coordinates for d1x7qa1.
(The format of our PDB-style files is described here.)

Timeline for d1x7qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x7qa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1x7qb_