![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Cold-inducible RNA-binding protein [143300] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143301] (1 PDB entry) Uniprot Q14011 1-90 |
![]() | Domain d1x5sa1: 1x5s A:8-96 [121719] Other proteins in same PDB: d1x5sa2, d1x5sa3 |
PDB Entry: 1x5s (more details)
SCOPe Domain Sequences for d1x5sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5sa1 d.58.7.1 (A:8-96) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} masdegklfvgglsfdtneqsleqvfskygqisevvvvkdretqrsrgfgfvtfenidda kdammamngksvdgrqirvdqagkssdnr
Timeline for d1x5sa1: