Lineage for d1x4ka1 (1x4k A:35-66)
- Root: SCOP 1.75
Class g: Small proteins [56992] (90 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
alpha+beta metal(zinc)-bound foldSuperfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) 
Family g.39.1.3: LIM domain [57736] (18 proteins)
duplication: contains two (sub)domains of this fold
Protein Four and a half LIM domains protein 2, FHL2 [144161] (1 species)
Skeletal muscle lim-protein 3Species Human (Homo sapiens) [TaxId:9606] [144162] (3 PDB entries)
Uniprot Q14192 128-159! Uniprot Q14192 162-186! Uniprot Q14192 187-218! Uniprot Q14192 221-249! Uniprot Q14192 250-279! Uniprot Q14192 98-127
Domain d1x4ka1: 1x4k A:35-66 [121691]
2nd LIM domain
complexed with zn
Details for d1x4ka1
PDB Entry: 1x4k (more details)
PDB Description: solution structure of lim domain in lim-protein 3
PDB Compounds: (A:) Skeletal muscle LIM-protein 3SCOP Domain Sequences for d1x4ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]}
ichrcqqpigtksfipkdnqnfcvpcyekqha
SCOP Domain Coordinates for d1x4ka1:
Click to download the PDB-style file with coordinates for d1x4ka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1x4ka1:
- d1x4ka1 first appeared in SCOP 1.73
- d1x4ka1 appears in SCOPe 2.01
- d1x4ka1 appears in the current release, SCOPe 2.08
View in 3D
