Lineage for d1x4ga1 (1x4g A:8-103)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952033Protein Nucleolysin TIAR [143298] (1 species)
  7. 2952034Species Human (Homo sapiens) [TaxId:9606] [143299] (3 PDB entries)
    Uniprot Q01085 1-90! Uniprot Q01085 187-282
  8. 2952037Domain d1x4ga1: 1x4g A:8-103 [121689]
    Other proteins in same PDB: d1x4ga2, d1x4ga3
    2nd RBD

Details for d1x4ga1

PDB Entry: 1x4g (more details)

PDB Description: solution structure of rrm domain in nucleolysin tiar
PDB Compounds: (A:) Nucleolysin TIAR

SCOPe Domain Sequences for d1x4ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}
ntkqlrfedvvnqsspknctvycggiasgltdqlmrqtfspfgqimeirvfpekgysfvr
fsthesaahaivsvngttieghvvkcywgkespdmt

SCOPe Domain Coordinates for d1x4ga1:

Click to download the PDB-style file with coordinates for d1x4ga1.
(The format of our PDB-style files is described here.)

Timeline for d1x4ga1: