Lineage for d1x41a1 (1x41 A:8-54)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691946Protein Transcriptional adaptor 2-like, TADA2L, isoform b [140145] (1 species)
  7. 2691947Species Human (Homo sapiens) [TaxId:9606] [140146] (1 PDB entry)
    Uniprot Q9BVJ0 72-118
  8. 2691948Domain d1x41a1: 1x41 A:8-54 [121676]
    Other proteins in same PDB: d1x41a2, d1x41a3

Details for d1x41a1

PDB Entry: 1x41 (more details)

PDB Description: solution structure of the myb-like dna binding domain of human transcriptional adaptor 2-like, isoform b
PDB Compounds: (A:) Transcriptional adaptor 2-like, isoform b

SCOPe Domain Sequences for d1x41a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]}
dpswtaqeemalleavmdcgfgnwqdvanqmctktkeecekhymkyf

SCOPe Domain Coordinates for d1x41a1:

Click to download the PDB-style file with coordinates for d1x41a1.
(The format of our PDB-style files is described here.)

Timeline for d1x41a1: