Lineage for d1x3wb1 (1x3w B:253-309)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349229Fold a.189: XPC-binding domain [101237] (1 superfamily)
    4 helices; array
  4. 2349230Superfamily a.189.1: XPC-binding domain [101238] (2 families) (S)
  5. 2349231Family a.189.1.1: XPC-binding domain [101239] (4 proteins)
  6. 2349232Protein Rad23 STI1 domain [140601] (1 species)
  7. 2349233Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140602] (1 PDB entry)
    Uniprot P32628 253-309
  8. 2349234Domain d1x3wb1: 1x3w B:253-309 [121672]
    Other proteins in same PDB: d1x3wa1
    complexed with suc, zn

Details for d1x3wb1

PDB Entry: 1x3w (more details), 3 Å

PDB Description: structure of a peptide:n-glycanase-rad23 complex
PDB Compounds: (B:) UV excision repair protein RAD23

SCOPe Domain Sequences for d1x3wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3wb1 a.189.1.1 (B:253-309) Rad23 STI1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsigltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav

SCOPe Domain Coordinates for d1x3wb1:

Click to download the PDB-style file with coordinates for d1x3wb1.
(The format of our PDB-style files is described here.)

Timeline for d1x3wb1:

2349234
d1x3wb1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1x3wa1