![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
![]() | Protein Peptide:N-glycanase 1, PNG1 [142852] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142853] (1 PDB entry) Uniprot Q02890 8-327 |
![]() | Domain d1x3wa1: 1x3w A:8-327 [121671] Other proteins in same PDB: d1x3wb1 complexed with suc, zn |
PDB Entry: 1x3w (more details), 3 Å
SCOPe Domain Sequences for d1x3wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3wa1 d.3.1.4 (A:8-327) Peptide:N-glycanase 1, PNG1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nnidfdsiakmllikykdfilskfkkaapvenirfqnlvhtnqfaqgvlgqsqhlctvyd npswhsivletldldliyknvdkefakdghaegeniytdylvkellryfkqdffkwcnkp dcnhcgqntsenmtplgsqgpngeeskfncgtveiykcnrcgnitrfpryndpiklletr kgrcgewcnlftlilksfgldvryvwnredhvwceyfsnflnrwvhvdsceqsfdqpyiy sinwnkkmsyciafgkdgvvdvskryilqnelprdqikeedlkflcqfitkrlryslndd eiyqlacrdeqeqielirgk
Timeline for d1x3wa1: