Class b: All beta proteins [48724] (180 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.11: Kelch motif [117281] (2 families) |
Family b.68.11.1: Kelch motif [117282] (2 proteins) Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967) |
Protein Kelch-like ECH-associated protein 1, KEAP1 [117283] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141550] (2 PDB entries) Uniprot Q9Z2X8 324-613 |
Domain d1x2ja1: 1x2j A:324-613 [121643] complexed with so4; mutant |
PDB Entry: 1x2j (more details), 1.6 Å
SCOPe Domain Sequences for d1x2ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2ja1 b.68.11.1 (A:324-613) Kelch-like ECH-associated protein 1, KEAP1 {Mouse (Mus musculus) [TaxId: 10090]} vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc
Timeline for d1x2ja1: