Lineage for d1x2ja1 (1x2j A:324-613)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808612Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2808613Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2808614Protein Kelch-like ECH-associated protein 1, KEAP1 [117283] (2 species)
  7. 2808619Species Mouse (Mus musculus) [TaxId:10090] [141550] (2 PDB entries)
    Uniprot Q9Z2X8 324-613
  8. 2808620Domain d1x2ja1: 1x2j A:324-613 [121643]
    complexed with so4; mutant

Details for d1x2ja1

PDB Entry: 1x2j (more details), 1.6 Å

PDB Description: Structural basis for the defects of human lung cancer somatic mutations in the repression activity of Keap1 on Nrf2
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d1x2ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2ja1 b.68.11.1 (A:324-613) Kelch-like ECH-associated protein 1, KEAP1 {Mouse (Mus musculus) [TaxId: 10090]}
vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns
pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery
eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm
ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq
gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc

SCOPe Domain Coordinates for d1x2ja1:

Click to download the PDB-style file with coordinates for d1x2ja1.
(The format of our PDB-style files is described here.)

Timeline for d1x2ja1: