Lineage for d1x23a1 (1x23 A:1-147)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) 
Species Human (Homo sapiens), E2 D3 [TaxId:9606] [143054] (3 PDB entries)
Uniprot P61077 1-147
Domain d1x23a1: 1x23 A:1-147 [121615]
Other proteins in same PDB: d1x23b_, d1x23c_, d1x23d_
Details for d1x23a1
PDB Entry: 1x23 (more details), 1.85 Å
PDB Description: Crystal structure of ubch5c
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3SCOPe Domain Sequences for d1x23a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x23a1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 D3 [TaxId: 9606]}
malkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrdkynrisrewtqkyam
SCOPe Domain Coordinates for d1x23a1:
Click to download the PDB-style file with coordinates for d1x23a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1x23a1:
- d1x23a1 first appeared in SCOP 1.73
- d1x23a1 appears in SCOPe 2.01
- d1x23a1 appears in SCOPe 2.03
- d1x23a1 appears in the current release, SCOPe 2.08
View in 3D
