![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies) sandwich, 10 strands in 2 sheets; "folded meander" |
![]() | Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) ![]() |
![]() | Family b.24.1.0: automated matches [254204] (1 protein) not a true family |
![]() | Protein automated matches [254449] (1 species) not a true protein |
![]() | Species Bacillus sp. [TaxId:84635] [254960] (5 PDB entries) |
![]() | Domain d1x1ia2: 1x1i A:660-777 [121585] Other proteins in same PDB: d1x1ia1, d1x1ia3 automated match to d1x1ia2 complexed with 46m |
PDB Entry: 1x1i (more details), 1.8 Å
SCOPe Domain Sequences for d1x1ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1ia2 b.24.1.0 (A:660-777) automated matches {Bacillus sp. [TaxId: 84635]} paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg
Timeline for d1x1ia2: