Lineage for d1x0xa2 (1x0x A:194-349)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetrySuperfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) 
N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
Family a.100.1.0: automated matches [227147] (1 protein)
not a true familyProtein automated matches [226851] (23 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225061] (10 PDB entries) 
Domain d1x0xa2: 1x0x A:194-349 [203070]
Other proteins in same PDB: d1x0xa1
automated match to d1evya1
complexed with nad, so4
Details for d1x0xa2
PDB Entry: 1x0x (more details), 2.75 Å
PDB Description: co-structure of homo sapiens glycerol-3-phosphate dehydrogenase 1 complex with nad
PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmicSCOPe Domain Sequences for d1x0xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0xa2 a.100.1.0 (A:194-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssatfl
escgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetarelysilqhk
glvdkfplfmavykvcyegqpvgefihclqnhpehm
SCOPe Domain Coordinates for d1x0xa2:
Click to download the PDB-style file with coordinates for d1x0xa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1x0xa2:
- d1x0xa2 is new in SCOPe 2.03-stable
- d1x0xa2 appears in SCOPe 2.04
- d1x0xa2 appears in the current release, SCOPe 2.08
View in 3D
