Class b: All beta proteins [48724] (180 folds) |
Fold b.124: HesB-like domain [89359] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
Superfamily b.124.1: HesB-like domain [89360] (2 families) |
Family b.124.1.0: automated matches [227171] (1 protein) not a true family |
Protein automated matches [226886] (3 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [225076] (1 PDB entry) |
Domain d1x0ga_: 1x0g A: [203049] automated match to d1nwba_ complexed with fes, na |
PDB Entry: 1x0g (more details), 2.5 Å
SCOPe Domain Sequences for d1x0ga_:
Sequence, based on SEQRES records: (download)
>d1x0ga_ b.124.1.0 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsrs
>d1x0ga_ b.124.1.0 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} mveltpaaiqelerlqilriqvqpsecgdwrydlalvaepkptdlltqsqgwtiaiaaea aellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsrs
Timeline for d1x0ga_: