Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Nuclear ribonucleoprotein D0 (AUF1) [75439] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75440] (3 PDB entries) |
Domain d1x0fa1: 1x0f A:183-257 [121546] automatically matched to d1iqta_ protein/DNA complex; protein/RNA complex |
PDB Entry: 1x0f (more details)
SCOPe Domain Sequences for d1x0fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} kifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkimek kyhnvglskceikva
Timeline for d1x0fa1: