Lineage for d1x0fa1 (1x0f A:183-257)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1415603Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1415757Protein Nuclear ribonucleoprotein D0 (AUF1) [75439] (1 species)
  7. 1415758Species Human (Homo sapiens) [TaxId:9606] [75440] (3 PDB entries)
  8. 1415759Domain d1x0fa1: 1x0f A:183-257 [121546]
    automatically matched to d1iqta_
    protein/DNA complex; protein/RNA complex

Details for d1x0fa1

PDB Entry: 1x0f (more details)

PDB Description: complex structure of the c-terminal rna-binding domain of hnrnp d(auf1) with telomeric dna
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein D0

SCOPe Domain Sequences for d1x0fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}
kifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkimek
kyhnvglskceikva

SCOPe Domain Coordinates for d1x0fa1:

Click to download the PDB-style file with coordinates for d1x0fa1.
(The format of our PDB-style files is described here.)

Timeline for d1x0fa1: