Lineage for d1x05a1 (1x05 A:8-123)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1798840Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1798975Protein Pleckstrin [50740] (1 species)
  7. 1798976Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)
  8. 1798983Domain d1x05a1: 1x05 A:8-123 [121543]
    2nd PH domain

Details for d1x05a1

PDB Entry: 1x05 (more details)

PDB Description: solution structure of the c-terminal ph domain of human pleckstrin
PDB Compounds: (A:) Pleckstrin

SCOPe Domain Sequences for d1x05a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x05a1 b.55.1.1 (A:8-123) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
vilkeefrgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrg
cvvtsvesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasrtgk

SCOPe Domain Coordinates for d1x05a1:

Click to download the PDB-style file with coordinates for d1x05a1.
(The format of our PDB-style files is described here.)

Timeline for d1x05a1: