Lineage for d1wzla1 (1wzl A:1-120)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524658Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1524659Protein automated matches [190226] (39 species)
    not a true protein
  7. Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (6 PDB entries)
  8. 1524849Domain d1wzla1: 1wzl A:1-120 [121513]
    Other proteins in same PDB: d1wzla2, d1wzla3, d1wzlb2, d1wzlb3
    automated match to d1wzla1
    complexed with ca

Details for d1wzla1

PDB Entry: 1wzl (more details), 2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) mutatnt r469l
PDB Compounds: (A:) alpha-amylase II

SCOPe Domain Sequences for d1wzla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzla1 b.1.18.0 (A:1-120) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOPe Domain Coordinates for d1wzla1:

Click to download the PDB-style file with coordinates for d1wzla1.
(The format of our PDB-style files is described here.)

Timeline for d1wzla1: