Lineage for d1wzca1 (1wzc A:1-243)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
contains an alpha+beta subdomain inserted into a new site after strand 3
Protein Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) [117505] (2 species) Species Pyrococcus horikoshii [TaxId:53953] [142156] (1 PDB entry)
Uniprot O58690 1-243
Domain d1wzca1: 1wzc A:1-243 [121491]
complexed with mg, po4
Details for d1wzca1
PDB Entry: 1wzc (more details), 1.9 Å
PDB Description: crystal structure of pyrococcus horikoshii mannosyl-3-phosphoglycerate phosphatase complexed with mg2+ and phosphate
PDB Compounds: (A:) Mannosyl-3-phosphoglycerate phosphataseSCOPe Domain Sequences for d1wzca1:
Sequence, based on SEQRES records: (download)
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Pyrococcus horikoshii [TaxId: 53953]}
mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk
eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk
gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle
vik
Sequence, based on observed residues (ATOM records): (download)
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Pyrococcus horikoshii [TaxId: 53953]}
mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
isengsaifipkgyfpyivielgirvekireelkkleniyglkyygnstkeeiekftgmp
pelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdkgkaakilldf
ykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvlevik
SCOPe Domain Coordinates for d1wzca1:
Click to download the PDB-style file with coordinates for d1wzca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wzca1:
- d1wzca1 first appeared in SCOP 1.73
- d1wzca1 appears in SCOP 1.75
- d1wzca1 appears in SCOPe 2.02
- d1wzca1 appears in the current release, SCOPe 2.08
View in 3D
