SCOPe 2.06: Domain d1wxwa1: 1wxw A:1-64

Lineage for d1wxwa1 (1wxw A:1-64)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.122: PUA domain-like [88696] (1 superfamily)
pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
Superfamily b.122.1: PUA domain-like [88697] (14 families)
Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
N-terminal part of Pfam PF03602, structurally similar to PUA domain family
Protein Hypothetical protein TTHA1280, N-terminal domain [141717] (1 species)
Species Thermus thermophilus [TaxId:274] [141718] (3 PDB entries)
Uniprot Q5SIT4 1-164
Domain d1wxwa1: 1wxw A:1-64 [121410]
Other proteins in same PDB: d1wxwa2, d1wxwb2, d1wxwc2, d1wxwd2
complexed with hez

Details for d1wxwa1

PDB Entry: 1wxw (more details), 2.55 Å

PDB Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8

PDB Compounds: (A:) hypothetical protein TTHA1280

SCOPe Domain Sequences for d1wxwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxwa1 b.122.1.9 (A:1-64) Hypothetical protein TTHA1280, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
rfap

SCOPe Domain Coordinates for d1wxwa1:

Click to download the PDB-style file with coordinates for d1wxwa1.
(The format of our PDB-style files is described here.)

Timeline for d1wxwa1: