Lineage for d1wx9a1 (1wx9 A:8-80)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177389Protein Large proline-rich protein BAT3 [142952] (1 species)
  7. 2177390Species Human (Homo sapiens) [TaxId:9606] [142953] (1 PDB entry)
    Uniprot P46379 17-89
  8. 2177391Domain d1wx9a1: 1wx9 A:8-80 [121394]
    Other proteins in same PDB: d1wx9a2, d1wx9a3

Details for d1wx9a1

PDB Entry: 1wx9 (more details)

PDB Description: solution structure of the n-terminal ubiquitin-like domain in the human bat3 protein
PDB Compounds: (A:) HLA-B associated transcript-3 isoform b

SCOPe Domain Sequences for d1wx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]}
levlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqddkklqeyn
vggkvihlverap

SCOPe Domain Coordinates for d1wx9a1:

Click to download the PDB-style file with coordinates for d1wx9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wx9a1: