SCOPe 2.08: Domain d1wwra1: 1wwr A:1-151

Lineage for d1wwra1 (1wwr A:1-151)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
contains extra C-terminal strand 5, order 21345
Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
strand 5 is parallel to strand 4
Protein tRNA adenosine deaminase TadA [142840] (3 species)
Species Aquifex aeolicus [TaxId:63363] [142843] (1 PDB entry)
Uniprot O67050 1-151
Domain d1wwra1: 1wwr A:1-151 [121366]
Other proteins in same PDB: d1wwra2, d1wwrb3, d1wwrc3
complexed with zn

Details for d1wwra1

PDB Entry: 1wwr (more details), 1.8 Å

PDB Description: Crystal structure of tRNA adenosine deaminase TadA from Aquifex aeolicus

PDB Compounds: (A:) tRNA adenosine deaminase TadA

SCOPe Domain Sequences for d1wwra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwra1 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 63363]}
mgkeyflkvalreakrafekgevpvgaiivkegeiiskahnsveelkdptahaemlaike
acrrlntkylegcelyvtlepcimcsyalvlsriekvifsaldkkhggvvsvfnildept
lnhrvkweyypleeasellseffkklrnnii

SCOPe Domain Coordinates for d1wwra1:

Click to download the PDB-style file with coordinates for d1wwra1.
(The format of our PDB-style files is described here.)

Timeline for d1wwra1: