Lineage for d1wwqa1 (1wwq A:8-111)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.330: ERH-like [143874] (1 superfamily)
beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10Superfamily d.330.1: ERH-like [143875] (2 families) 
automatically mapped to Pfam PF01133Family d.330.1.1: ERH-like [143876] (2 proteins)
Pfam PF01133Protein Enhancer of rudimentary homolog, ERH [143877] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [143878] (5 PDB entries)
Uniprot P84089 1-104! Uniprot P84090 2-101
also includes 100% identical human protein P84090 (1W9G)
Domain d1wwqa1: 1wwq A:8-111 [121365]
Other proteins in same PDB: d1wwqa2
Details for d1wwqa1
PDB Entry: 1wwq (more details)
PDB Description: solution structure of mouse er
PDB Compounds: (A:) Enhancer of rudimentary homologSCOPe Domain Sequences for d1wwqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwqa1 d.330.1.1 (A:8-111) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk
SCOPe Domain Coordinates for d1wwqa1:
Click to download the PDB-style file with coordinates for d1wwqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wwqa1:
- d1wwqa1 first appeared in SCOP 1.73
- d1wwqa1 appears in SCOPe 2.07
View in 3D
