Lineage for d1wvra1 (1wvr A:1-164)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.111: PR-1-like [55796] (1 superfamily)
alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342Superfamily d.111.1: PR-1-like [55797] (2 families) 
Family d.111.1.1: PR-1-like [55798] (5 proteins)
Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
Protein automated matches [194852] (4 species)
not a true protein
Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [224988] (1 PDB entry) 
Domain d1wvra1: 1wvr A:1-164 [203025]
Other proteins in same PDB: d1wvra2
automated match to d1rc9a1
complexed with cd
Details for d1wvra1
PDB Entry: 1wvr (more details), 2.4 Å
PDB Description: crystal structure of a crisp family ca-channel blocker derived from snake venom
PDB Compounds: (A:) TriflinSCOPe Domain Sequences for d1wvra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvra1 d.111.1.1 (A:1-164) automated matches {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
nvdfdsesprkpeiqneiidlhnslrrsvnptasnmlkmewypeaaanaerwayrciesh
ssrdsrviggikcgeniymatypakwtdiihawhgeykdfkygvgavpsdavighytqiv
wyksyragcaaaycpsskysyfyvcqycpagniigktatpyksg
SCOPe Domain Coordinates for d1wvra1:
Click to download the PDB-style file with coordinates for d1wvra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wvra1:
- d1wvra1 first appeared in SCOPe 2.03
- d1wvra1 appears in SCOPe 2.07
View in 3D
