Lineage for d1wvna1 (1wvn A:5-74)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025556Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1025557Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1025558Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins)
    an RNA-binding domain
  6. 1025607Protein Poly(RC)-binding protein 1 [143224] (1 species)
  7. 1025608Species Human (Homo sapiens) [TaxId:9606] [143225] (1 PDB entry)
    Uniprot Q15365 279-348
  8. 1025609Domain d1wvna1: 1wvn A:5-74 [121345]
    3rd KH domain

Details for d1wvna1

PDB Entry: 1wvn (more details), 2.1 Å

PDB Description: crystal structure of domain 3 of human alpha polyc binding protein
PDB Compounds: (A:) Poly(rC)-binding protein 1

SCOPe Domain Sequences for d1wvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}
qttheltipnnligciigrqganineirqmsgaqikianpvegssgrqvtitgsaasisl
aqylinarls

SCOPe Domain Coordinates for d1wvna1:

Click to download the PDB-style file with coordinates for d1wvna1.
(The format of our PDB-style files is described here.)

Timeline for d1wvna1: