Lineage for d1wvna1 (1wvn A:5-74)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/betaSuperfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) 
Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
an RNA-binding domain
Protein Poly(RC)-binding protein 1 [143224] (1 species) Species Human (Homo sapiens) [TaxId:9606] [143225] (1 PDB entry)
Uniprot Q15365 279-348
Domain d1wvna1: 1wvn A:5-74 [121345]
Other proteins in same PDB: d1wvna2
3rd KH domain
Details for d1wvna1
PDB Entry: 1wvn (more details), 2.1 Å
PDB Description: crystal structure of domain 3 of human alpha polyc binding protein
PDB Compounds: (A:) Poly(rC)-binding protein 1SCOPe Domain Sequences for d1wvna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}
qttheltipnnligciigrqganineirqmsgaqikianpvegssgrqvtitgsaasisl
aqylinarls
SCOPe Domain Coordinates for d1wvna1:
Click to download the PDB-style file with coordinates for d1wvna1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wvna1:
- d1wvna1 first appeared in SCOP 1.73
- d1wvna1 appears in SCOPe 2.07
View in 3D
