Lineage for d1wvfa2 (1wvf A:7-242)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
consists of two alpha+beta subdomainsSuperfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) 
Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins) 
Protein automated matches [254445] (3 species)
not a true proteinSpecies Pseudomonas putida [TaxId:303] [254950] (2 PDB entries) 
Domain d1wvfa2: 1wvf A:7-242 [121338]
Other proteins in same PDB: d1wvfa1
automated match to d1wvfa2
complexed with acy, cl, fad, gol
Details for d1wvfa2
PDB Entry: 1wvf (more details), 1.3 Å
PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
PDB Compounds: (A:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunitSCOPe Domain Sequences for d1wvfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvfa2 d.145.1.1 (A:7-242) automated matches {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp
SCOPe Domain Coordinates for d1wvfa2:
Click to download the PDB-style file with coordinates for d1wvfa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wvfa2:
- d1wvfa2 first appeared in SCOP 1.73
- d1wvfa2 appears in SCOPe 2.07
View in 3D
