Lineage for d1wufa1 (1wuf A:1127-1370)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1343858Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins)
  6. 1343979Protein N-acylamino acid racemase [110372] (4 species)
  7. 1344017Species Listeria innocua [TaxId:1642] [117383] (1 PDB entry)
    Uniprot Q927X3; Lin2664; protein assignment by sequence similarity
  8. 1344018Domain d1wufa1: 1wuf A:1127-1370 [114896]
    Other proteins in same PDB: d1wufa2, d1wufb2
    Structural genomics target
    complexed with mg

Details for d1wufa1

PDB Entry: 1wuf (more details), 2.9 Å

PDB Description: crystal structure of protein gi:16801725, member of enolase superfamily from listeria innocua clip11262
PDB Compounds: (A:) hypothetical protein lin2664

SCOPe Domain Sequences for d1wufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]}
tkesikvgvsiglqqnvetllqlvnqyvdqgyervklkiapnkdiqfveavrksfpklsl
madansaynredflllkeldqydlemieqpfgtkdfvdhawlqkqlktricldenirsvk
dveqahsigscrainlklarvggmssalkiaeycalneilvwcggmleagvgrahniala
arnefvfpgdisasnrffaedivtpafelnqgrlkvptnegigvtldlkvlkkytkstee
illn

SCOPe Domain Coordinates for d1wufa1:

Click to download the PDB-style file with coordinates for d1wufa1.
(The format of our PDB-style files is described here.)

Timeline for d1wufa1:

1344018
d1wufa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1wufa2