Lineage for d1wu7a1 (1wu7 A:330-426)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) 
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) 
Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species) 
Species Thermoplasma acidophilum [TaxId:2303] [142418] (1 PDB entry)
Uniprot Q9HLX5 330-426
Domain d1wu7a1: 1wu7 A:330-426 [121275]
Other proteins in same PDB: d1wu7a2, d1wu7b2
Details for d1wu7a1
PDB Entry: 1wu7 (more details), 2.4 Å
PDB Description: Crystal structure of histidyl-tRNA synthetase from Thermoplasma acidophilum
PDB Compounds: (A:) histidyl-tRNA synthetaseSCOPe Domain Sequences for d1wu7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wu7a1 c.51.1.1 (A:330-426) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
rekksvyicrvgkinssimneysrklrergmnvtveimerglsaqlkyasaigadfavif
gerdlergvvtirnmytgsqenvgldsvvehlisqat
SCOPe Domain Coordinates for d1wu7a1:
Click to download the PDB-style file with coordinates for d1wu7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wu7a1:
- d1wu7a1 first appeared in SCOP 1.73
- d1wu7a1 appears in SCOPe 2.06
- d1wu7a1 appears in the current release, SCOPe 2.08
View in 3D
