Lineage for d1wsic_ (1wsi C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493669Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2493851Protein RNase H (RNase HI) [53100] (4 species)
  7. 2493852Species Escherichia coli [TaxId:562] [53101] (33 PDB entries)
    Uniprot P0A7Y4
  8. 2493868Domain d1wsic_: 1wsi C: [114855]
    mutant

Details for d1wsic_

PDB Entry: 1wsi (more details), 2 Å

PDB Description: crystal structure of e.coli rnase hi active site mutant (e48a/k87a/d134n)
PDB Compounds: (C:) ribonuclease hi

SCOPe Domain Sequences for d1wsic_:

Sequence, based on SEQRES records: (download)

>d1wsic_ c.55.3.1 (C:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
kghaghpenercnelaraaamnptledtgyqvev

Sequence, based on observed residues (ATOM records): (download)

>d1wsic_ c.55.3.1 (C:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
kgaghpenercnelaraaamnptledtgyqvev

SCOPe Domain Coordinates for d1wsic_:

Click to download the PDB-style file with coordinates for d1wsic_.
(The format of our PDB-style files is described here.)

Timeline for d1wsic_: