Lineage for d1wrga_ (1wrg A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955548Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 1955549Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 1955603Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 1955604Protein automated matches [254444] (2 species)
    not a true protein
  7. 1955605Species Rhodospirillum rubrum [TaxId:1085] [254949] (1 PDB entry)
  8. 1955606Domain d1wrga_: 1wrg A: [240908]
    automated match to d1jo5a_

Details for d1wrga_

PDB Entry: 1wrg (more details)

PDB Description: light-harvesting complex 1 beta subunit from wild-type rhodospirillum rubrum
PDB Compounds: (A:) Light-harvesting protein B-880, beta chain

SCOPe Domain Sequences for d1wrga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wrga_ f.3.1.0 (A:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
aevkqeslsgitegeakefhkiftssilvffgvaafahllvwiwrpwvpgpngys

SCOPe Domain Coordinates for d1wrga_:

Click to download the PDB-style file with coordinates for d1wrga_.
(The format of our PDB-style files is described here.)

Timeline for d1wrga_: