Lineage for d1wrda1 (1wrd A:215-307)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
3 helices; bundle, closed, left-handed twist; up-and-down
Superfamily a.7.8: GAT-like domain [89009] (3 families) 
Family a.7.8.1: GAT domain [89010] (4 proteins)
this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
Protein Target of Myb protein 1, TOM1 [158361] (1 species) Species Human (Homo sapiens) [TaxId:9606] [158362] (1 PDB entry)
Uniprot O60784 215-307
Domain d1wrda1: 1wrd A:215-307 [144565]
Other proteins in same PDB: d1wrda2, d1wrdb_
Details for d1wrda1
PDB Entry: 1wrd (more details), 1.75 Å
PDB Description: Crystal structure of Tom1 GAT domain in complex with ubiquitin
PDB Compounds: (A:) Target of Myb protein 1SCOPe Domain Sequences for d1wrda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wrda1 a.7.8.1 (A:215-307) Target of Myb protein 1, TOM1 {Human (Homo sapiens) [TaxId: 9606]}
eqigklrselemvsgnvrvmsemltelvptqaepadlellqelnrtcramqqrvlelipq
ianeqlteellivndnlnnvflrherferfrtg
SCOPe Domain Coordinates for d1wrda1:
Click to download the PDB-style file with coordinates for d1wrda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wrda1:
- d1wrda1 first appeared in SCOP 1.75
- d1wrda1 appears in SCOPe 2.07
View in 3D
