Lineage for d1wr0a1 (1wr0 A:5-81)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
3 helices; bundle, closed, left-handed twist; up-and-down
Superfamily a.7.14: MIT domain [116846] (2 families) 
Family a.7.14.1: MIT domain [116847] (4 proteins)
Pfam PF04212
this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain
Protein Vacuolar sorting protein 4b (VPS4B, SKD1 protein) [140354] (1 species) Species Human (Homo sapiens) [TaxId:9606] [140355] (4 PDB entries)
Uniprot O75351 1-104! Uniprot O75351 1-77
Domain d1wr0a1: 1wr0 A:5-81 [121183]
Other proteins in same PDB: d1wr0a2
Details for d1wr0a1
PDB Entry: 1wr0 (more details)
PDB Description: structural characterization of the mit domain from human vps4b
PDB Compounds: (A:) SKD1 proteinSCOPe Domain Sequences for d1wr0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]}
msstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsira
kcteyldraeklkeylk
SCOPe Domain Coordinates for d1wr0a1:
Click to download the PDB-style file with coordinates for d1wr0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wr0a1:
- d1wr0a1 first appeared in SCOP 1.73
- d1wr0a1 appears in SCOPe 2.06
- d1wr0a1 appears in the current release, SCOPe 2.08
View in 3D
