Lineage for d1wpwa_ (1wpw A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
consists of two intertwined (sub)domains related by pseudo dyad; duplication
3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the restSuperfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) 
the constituent families form similar dimers
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
the active site is between the two identical subunits
Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species) 
Species Sulfolobus tokodaii [TaxId:111955] [117724] (1 PDB entry)
Uniprot P50455
Domain d1wpwa_: 1wpw A: [114830]
complexed with mg
Details for d1wpwa_
PDB Entry: 1wpw (more details), 2.8 Å
PDB Description: Crystal Structure of IPMDH from Sulfolobus tokodaii
PDB Compounds: (A:) 3-isopropylmalate dehydrogenaseSCOPe Domain Sequences for d1wpwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpwa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]}
gftvaliqgdgigpeivskskrilakinelyslpieyieveagdralarygealpkdslk
iidkadiilkgpvgesaadvvvklrqiydmyanirpaksipgidtkygnvdilivrente
dlykgfehivsdgvavgmkiitrfaseriakvglnfalrrrkkvtcvhkanvmritdglf
aeacrsvlkgkveysemyvdaaaanlvrnpqmfdvivtenvygdilsdeasqiagslgia
psanigdkkalfepvhgaafdiagknignptafllsvsmmyermyelsnddryikasral
enaiylvykerkaltpdvggnattddlineiynklg
SCOPe Domain Coordinates for d1wpwa_:
Click to download the PDB-style file with coordinates for d1wpwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wpwa_:
- d1wpwa_ first appeared in SCOP 1.71
- d1wpwa_ appears in SCOPe 2.07
View in 3D
