Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) a distorted variant of double-helix |
Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins) |
Protein Calcium ATPase, transduction domain A [81651] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (43 PDB entries) Uniprot P04191 |
Domain d1wpga1: 1wpg A:125-239 [114806] Other proteins in same PDB: d1wpga2, d1wpga3, d1wpga4, d1wpgb2, d1wpgb3, d1wpgb4, d1wpgc2, d1wpgc3, d1wpgc4, d1wpgd2, d1wpgd3, d1wpgd4 complexed with adp, mf4, mg, na, tg1 |
PDB Entry: 1wpg (more details), 2.3 Å
SCOPe Domain Sequences for d1wpga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpga1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d1wpga1: