Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.17: occludin/ELL-like [144292] (2 families) antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731) |
Family h.4.17.1: Occludin/ELL domain [144293] (1 protein) Pfam PF07303 |
Protein Occludin [144294] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144295] (3 PDB entries) Uniprot Q16625 416-522 |
Domain d1wpaa1: 1wpa A:416-522 [121145] |
PDB Entry: 1wpa (more details), 1.5 Å
SCOPe Domain Sequences for d1wpaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpaa1 h.4.17.1 (A:416-522) Occludin {Human (Homo sapiens) [TaxId: 9606]} wireyppitsdqqrqlykrnfdtglqeykslqseldeinkelsrldkelddyreeseeym aaadeynrlkqvkgsadykskknhckqlksklshikkmvgdydrqkt
Timeline for d1wpaa1: