Lineage for d1wp1a_ (1wp1 A:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1455515Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. 1455516Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. 1455517Family f.5.1.1: Outer membrane efflux proteins (OEP) [56955] (3 proteins)
    Pfam PF02321
  6. 1455526Protein Outer membrane protein OprM [118229] (1 species)
  7. 1455527Species Pseudomonas aeruginosa [TaxId:287] [118230] (2 PDB entries)
    Uniprot Q51487 18-485
  8. 1455531Domain d1wp1a_: 1wp1 A: [114778]

Details for d1wp1a_

PDB Entry: 1wp1 (more details), 2.56 Å

PDB Description: Crystal structure of the drug-discharge outer membrane protein, OprM
PDB Compounds: (A:) Outer membrane protein oprM

SCOPe Domain Sequences for d1wp1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wp1a_ f.5.1.1 (A:) Outer membrane protein OprM {Pseudomonas aeruginosa [TaxId: 287]}
cslipdyqrpeapvaaaypqgqaygqntgaaavpaadigwreffrdpqlqqligvalenn
rdlrvaalnveafraqyriqradlfprigvdgsgtrqrlpgdlsttgspaissqygvtlg
ttaweldlfgrlrslrdqaleqylateqaqrsaqttlvasvatayltlkadqaqlqltkd
tlgtyqksfdltqrsydvgvasaldlrqaqtavegaratlaqytrlvaqdqnalvlllgs
gipanlpqglgldqtlltevpaglpsdllqrrpdileaehqlmaanasigaaraaffpsi
sltanagtmsrqlsglfdagsgswlfqpsinlpiftagslrasldyakiqkdinvaqyek
aiqtafqevadglaargtfteqlqaqrdlvkasdeyyqladkryrtgvdnyltlldaqrs
lftaqqqlitdrlnqltsevnlykalgggwnqqtvt

SCOPe Domain Coordinates for d1wp1a_:

Click to download the PDB-style file with coordinates for d1wp1a_.
(The format of our PDB-style files is described here.)

Timeline for d1wp1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wp1b_