| Class b: All beta proteins [48724] (178 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.24: Family 30 carbohydrate binding module, CBM30 (PKD repeat) [110125] (2 proteins) |
| Protein Endoglucanase CelJ [110126] (1 species) |
| Species Clostridium thermocellum [TaxId:1515] [110127] (2 PDB entries) Uniprot P71140 34-228 # chain B coverage |
| Domain d1wmxa_: 1wmx A: [109418] complexed with so4 |
PDB Entry: 1wmx (more details), 2 Å
SCOPe Domain Sequences for d1wmxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmxa_ b.18.1.24 (A:) Endoglucanase CelJ {Clostridium thermocellum [TaxId: 1515]}
lldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvqsgwwisl
ltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvisnyv
tvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitse
Timeline for d1wmxa_: