Lineage for d1wmia1 (1wmi A:1-88)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1231375Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 1231376Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 1231392Family d.298.1.2: RelE-like [143015] (3 proteins)
    Pfam PF05016
  6. 1231396Protein Hypothetical protein PHS013 [143016] (1 species)
  7. 1231397Species Pyrococcus horikoshii [TaxId:53953] [143017] (1 PDB entry)
    Uniprot O73966 1-88
  8. 1231398Domain d1wmia1: 1wmi A:1-88 [121045]
    Other proteins in same PDB: d1wmib1, d1wmic_, d1wmid_

Details for d1wmia1

PDB Entry: 1wmi (more details), 2.3 Å

PDB Description: Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3
PDB Compounds: (A:) hypothetical protein PHS013

SCOPe Domain Sequences for d1wmia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmia1 d.298.1.2 (A:1-88) Hypothetical protein PHS013 {Pyrococcus horikoshii [TaxId: 53953]}
mtyrvkihkqvvkalqslpkahyrrflefrdileyepvprekfdviklegtgdldlyrar
lgdyrviysvnwkdkvikilklkprgra

SCOPe Domain Coordinates for d1wmia1:

Click to download the PDB-style file with coordinates for d1wmia1.
(The format of our PDB-style files is described here.)

Timeline for d1wmia1: