Lineage for d1wkja1 (1wkj A:1-137)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) 
Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries)
Uniprot Q5SLV5 1-137
Domain d1wkja1: 1wkj A:1-137 [120983]
Details for d1wkja1
PDB Entry: 1wkj (more details), 2 Å
PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
PDB Compounds: (A:) Nucleoside diphosphate kinaseSCOPe Domain Sequences for d1wkja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]}
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell
SCOPe Domain Coordinates for d1wkja1:
Click to download the PDB-style file with coordinates for d1wkja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wkja1:
- d1wkja1 first appeared in SCOP 1.73
- d1wkja1 appears in SCOPe 2.02
- d1wkja1 appears in SCOPe 2.04
- d1wkja1 appears in the current release, SCOPe 2.08
View in 3D
