Lineage for d1wk2a_ (1wk2 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2432946Family b.122.1.5: Hypothetical protein TTHA0113 [117348] (2 proteins)
    Pfam PF04266; DUF437
  6. 2432947Protein Hypothetical protein TTHA0113 [117349] (1 species)
  7. 2432948Species Thermus thermophilus [TaxId:274] [117350] (1 PDB entry)
    Uniprot Q5SM30
  8. 2432949Domain d1wk2a_: 1wk2 A: [114720]
    Structural genomics target

Details for d1wk2a_

PDB Entry: 1wk2 (more details), 2.5 Å

PDB Description: Crystal structure of a hypothetical protein from thermus thermophilus HB8
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1wk2a_:

Sequence, based on SEQRES records: (download)

>d1wk2a_ b.122.1.5 (A:) Hypothetical protein TTHA0113 {Thermus thermophilus [TaxId: 274]}
merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvegpfs
veellahqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdlsevr

Sequence, based on observed residues (ATOM records): (download)

>d1wk2a_ b.122.1.5 (A:) Hypothetical protein TTHA0113 {Thermus thermophilus [TaxId: 274]}
merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvplyaw
vlenafryekplhvpmfvdlsevr

SCOPe Domain Coordinates for d1wk2a_:

Click to download the PDB-style file with coordinates for d1wk2a_.
(The format of our PDB-style files is described here.)

Timeline for d1wk2a_: