Class b: All beta proteins [48724] (178 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.5: Hypothetical protein TTHA0113 [117348] (2 proteins) Pfam PF04266; DUF437 |
Protein Hypothetical protein TTHA0113 [117349] (1 species) |
Species Thermus thermophilus [TaxId:274] [117350] (1 PDB entry) Uniprot Q5SM30 |
Domain d1wk2a_: 1wk2 A: [114720] Structural genomics target |
PDB Entry: 1wk2 (more details), 2.5 Å
SCOPe Domain Sequences for d1wk2a_:
Sequence, based on SEQRES records: (download)
>d1wk2a_ b.122.1.5 (A:) Hypothetical protein TTHA0113 {Thermus thermophilus [TaxId: 274]} merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvegpfs veellahqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdlsevr
>d1wk2a_ b.122.1.5 (A:) Hypothetical protein TTHA0113 {Thermus thermophilus [TaxId: 274]} merpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvplyaw vlenafryekplhvpmfvdlsevr
Timeline for d1wk2a_: