Lineage for d1wjga_ (1wjg A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2119957Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2120156Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. 2120177Protein Hypothetical protein TTHA0895 [117487] (1 species)
  7. 2120178Species Thermus thermophilus [TaxId:274] [117488] (1 PDB entry)
    Uniprot Q5SJV7
  8. 2120179Domain d1wjga_: 1wjg A: [114696]
    Structural genomics target

Details for d1wjga_

PDB Entry: 1wjg (more details), 2.1 Å

PDB Description: Crystal structure of a probable ATP binding protein from thermus themophilus HB8
PDB Compounds: (A:) probable ATP binding protein

SCOPe Domain Sequences for d1wjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjga_ c.26.2.4 (A:) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]}
fktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrler
aegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsq
sqrvvaeapcpvllv

SCOPe Domain Coordinates for d1wjga_:

Click to download the PDB-style file with coordinates for d1wjga_.
(The format of our PDB-style files is described here.)

Timeline for d1wjga_: