Lineage for d1wjba_ (1wjb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309001Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (2 families) (S)
  5. 2309002Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
    Zn-binding site is near the C-terminus
  6. 2309003Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)
  7. 2309004Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (8 PDB entries)
  8. 2309017Domain d1wjba_: 1wjb A: [16265]
    complexed with zn

Details for d1wjba_

PDB Entry: 1wjb (more details)

PDB Description: solution structure of the n-terminal zn binding domain of hiv-1 integrase (d form), nmr, 40 structures
PDB Compounds: (A:) hiv-1 integrase

SCOPe Domain Sequences for d1wjba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjba_ a.4.10.1 (A:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd

SCOPe Domain Coordinates for d1wjba_:

Click to download the PDB-style file with coordinates for d1wjba_.
(The format of our PDB-style files is described here.)

Timeline for d1wjba_:

2309017
d1wjba_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1wjbb_