Lineage for d1wj9a2 (1wj9 A:88-211)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (8 families) 
Family d.58.53.1: CRISPR-associated endoribonuclease Cse3-like [117988] (2 proteins)
duplication: contains two subdomains of this fold
Protein CRISPR-associated endoribonuclease Cse3 [117989] (1 species) Species Thermus thermophilus [TaxId:274] [117990] (1 PDB entry)
Uniprot Q53WG9
Domain d1wj9a2: 1wj9 A:88-211 [114695]
Structural genomics target
Details for d1wj9a2
PDB Entry: 1wj9 (more details), 1.9 Å
PDB Description: Crystal structure of a CRISPR-associated protein from thermus thermophilus
PDB Compounds: (A:) CRISPR-associated proteinSCOPe Domain Sequences for d1wj9a2:
Sequence, based on SEQRES records: (download)
>d1wj9a2 d.58.53.1 (A:88-211) CRISPR-associated endoribonuclease Cse3 {Thermus thermophilus [TaxId: 274]}
alkpgqrlrfrlranpakrlaatgkrvalktpaekvawlerrleeggfrllegergpwvq
ilqdtflevrrkkdgeeagkllqvqavlfegrlevvdperalatlrrgvgpgkalglgll
svap
Sequence, based on observed residues (ATOM records): (download)
>d1wj9a2 d.58.53.1 (A:88-211) CRISPR-associated endoribonuclease Cse3 {Thermus thermophilus [TaxId: 274]}
alkpgqrlrfrlranpakrlktpaekvawlerrleeggfrllegergpwvqilqdtfleq
vqavlfegrlevvdperalatlrrgvgpgkalglgllsvap
SCOPe Domain Coordinates for d1wj9a2:
Click to download the PDB-style file with coordinates for d1wj9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wj9a2:
- d1wj9a2 first appeared in SCOP 1.71
- d1wj9a2 appears in SCOPe 2.07
View in 3D
