| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (8 families) ![]() |
| Family d.58.53.1: CRISPR-associated endoribonuclease Cse3-like [117988] (2 proteins) duplication: contains two subdomains of this fold |
| Protein CRISPR-associated endoribonuclease Cse3 [117989] (1 species) |
| Species Thermus thermophilus [TaxId:274] [117990] (1 PDB entry) Uniprot Q53WG9 |
| Domain d1wj9a1: 1wj9 A:1-87 [114694] Structural genomics target |
PDB Entry: 1wj9 (more details), 1.9 Å
SCOPe Domain Sequences for d1wj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wj9a1 d.58.53.1 (A:1-87) CRISPR-associated endoribonuclease Cse3 {Thermus thermophilus [TaxId: 274]}
mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
vqtltepdwsvldegyaqvfppkpfhp
Timeline for d1wj9a1: