Lineage for d1wiea_ (1wie A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796433Protein RIM binding protein 2, RIMBP2 [117149] (1 species)
  7. 796434Species Human (Homo sapiens) [TaxId:9606] [117150] (1 PDB entry)
    Uniprot O15034 160-242
  8. 796435Domain d1wiea_: 1wie A: [114668]
    Structural genomics target

Details for d1wiea_

PDB Entry: 1wie (more details)

PDB Description: solution structure of the first sh3 domain of kiaa0318 protein
PDB Compounds: (A:) RIM binding protein 2

SCOP Domain Sequences for d1wiea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtskqrysgkvhlcvarysynpfdgpnenpeaelpltagkylyvygdmdedgfy
egelldgqrglvpsnfvdfvqdnesrlastsgpssg

SCOP Domain Coordinates for d1wiea_:

Click to download the PDB-style file with coordinates for d1wiea_.
(The format of our PDB-style files is described here.)

Timeline for d1wiea_: