Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Ribonucleoprotein PTB-binding 1, Raver-1 [143308] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [143309] (1 PDB entry) Uniprot Q9CW46 61-135 |
Domain d1wi6a1: 1wi6 A:69-143 [120974] |
PDB Entry: 1wi6 (more details)
SCOPe Domain Sequences for d1wi6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} ilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaaintfhqsrlre relsvqlqptdallc
Timeline for d1wi6a1: