Lineage for d1wi6a1 (1wi6 A:69-143)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028188Protein Ribonucleoprotein PTB-binding 1, Raver-1 [143308] (1 species)
  7. 1028189Species Mouse (Mus musculus) [TaxId:10090] [143309] (1 PDB entry)
    Uniprot Q9CW46 61-135
  8. 1028190Domain d1wi6a1: 1wi6 A:69-143 [120974]

Details for d1wi6a1

PDB Entry: 1wi6 (more details)

PDB Description: solution structure of the rna binding domain from mouse hypothetical protein bab23670
PDB Compounds: (A:) Hypothetical protein (RIKEN cDNA 1300006N24)

SCOPe Domain Sequences for d1wi6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}
ilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaaintfhqsrlre
relsvqlqptdallc

SCOPe Domain Coordinates for d1wi6a1:

Click to download the PDB-style file with coordinates for d1wi6a1.
(The format of our PDB-style files is described here.)

Timeline for d1wi6a1: