Lineage for d1wi0a_ (1wi0 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1893877Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 1893893Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 1893903Protein Mitogen activated protein kinase kinase 5, Map2k5 [117827] (2 species)
  7. 1893908Species Mouse (Mus musculus) [TaxId:10090] [117828] (1 PDB entry)
    Uniprot Q9D222 7-107
  8. 1893909Domain d1wi0a_: 1wi0 A: [114657]
    Structural genomics target

Details for d1wi0a_

PDB Entry: 1wi0 (more details)

PDB Description: solution structure of the pb1 domain of mouse mitogen activated protein kinase kinase 5 (map2k5)
PDB Compounds: (A:) Mitogen activated protein kinase kinase 5

SCOPe Domain Sequences for d1wi0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi0a_ d.15.2.2 (A:) Mitogen activated protein kinase kinase 5, Map2k5 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgpfcamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttaf
eyededgdritvrsdeemkamlsyyystvmeqqvngqlieplqifprsgpssg

SCOPe Domain Coordinates for d1wi0a_:

Click to download the PDB-style file with coordinates for d1wi0a_.
(The format of our PDB-style files is described here.)

Timeline for d1wi0a_: