Lineage for d1wgla_ (1wgl A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763589Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 763613Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 763751Family a.5.2.4: CUE domain [88995] (4 proteins)
    Pfam PF02845
  6. 763758Protein Toll-interacting protein [116837] (1 species)
  7. 763759Species Human (Homo sapiens) [TaxId:9606] [116838] (1 PDB entry)
    Uniprot Q9H0E2 229-274
  8. 763760Domain d1wgla_: 1wgl A: [114615]
    Structural genomics target

Details for d1wgla_

PDB Entry: 1wgl (more details)

PDB Description: solution structure of cue domain in the c-terminal of human toll- interacting protein (tollip)
PDB Compounds: (A:) Toll-interacting protein

SCOP Domain Sequences for d1wgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]}
gssgssgcseedlkaiqdmfpnmdqevirsvleaqrgnkdaainsllqmgeepsgpssg

SCOP Domain Coordinates for d1wgla_:

Click to download the PDB-style file with coordinates for d1wgla_.
(The format of our PDB-style files is described here.)

Timeline for d1wgla_: