Lineage for d1wgda_ (1wgd A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1637453Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1637534Protein Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 [117802] (1 species)
  7. 1637535Species Human (Homo sapiens) [TaxId:9606] [117803] (1 PDB entry)
    Uniprot Q15011 10-90
  8. 1637536Domain d1wgda_: 1wgd A: [114610]
    Structural genomics target

Details for d1wgda_

PDB Entry: 1wgd (more details)

PDB Description: solution structure of the ubl-domain of herp
PDB Compounds: (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein

SCOPe Domain Sequences for d1wgda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgvtllvkspnqrhrdlelsgdrgwsvghlkahlsrvyperprpedqrliysgkl
lldhqclrdllpkqekrhvlhlvcnvksgpssg

SCOPe Domain Coordinates for d1wgda_:

Click to download the PDB-style file with coordinates for d1wgda_.
(The format of our PDB-style files is described here.)

Timeline for d1wgda_: