Lineage for d1wf0a_ (1wf0 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028351Protein TAR DNA-binding protein 43, TDP-43 [117957] (1 species)
  7. 1028352Species Human (Homo sapiens) [TaxId:9606] [117958] (2 PDB entries)
    Uniprot Q13148 193-267
  8. 1028354Domain d1wf0a_: 1wf0 A: [114571]
    Structural genomics target

Details for d1wf0a_

PDB Entry: 1wf0 (more details)

PDB Description: solution structure of rrm domain in tar dna-binding protein-43
PDB Compounds: (A:) TAR DNA-binding protein-43

SCOPe Domain Sequences for d1wf0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgvfvgrctgdmtedelreffsqygdvmdvfipkpfrafafvtfaddqiaqslcg
edliikgisvhisnaepkhnsnsgpssg

SCOPe Domain Coordinates for d1wf0a_:

Click to download the PDB-style file with coordinates for d1wf0a_.
(The format of our PDB-style files is described here.)

Timeline for d1wf0a_: