Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein TAR DNA-binding protein 43, TDP-43 [117957] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117958] (2 PDB entries) Uniprot Q13148 193-267 |
Domain d1wf0a_: 1wf0 A: [114571] Structural genomics target |
PDB Entry: 1wf0 (more details)
SCOPe Domain Sequences for d1wf0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} gssgssgvfvgrctgdmtedelreffsqygdvmdvfipkpfrafafvtfaddqiaqslcg edliikgisvhisnaepkhnsnsgpssg
Timeline for d1wf0a_: