![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) ![]() |
![]() | Family g.50.1.2: PHD domain [57911] (13 proteins) |
![]() | Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118335] (2 PDB entries) Uniprot Q8C0D7 188-245 |
![]() | Domain d1wena_: 1wen A: [114560] Structural genomics target complexed with zn |
PDB Entry: 1wen (more details)
SCOP Domain Sequences for d1wena_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wena_ g.50.1.2 (A:) Inhibitor of growth protein 4, Ing4 {Mouse (Mus musculus) [TaxId: 10090]} gssgssgdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcp rcsqesgpssg
Timeline for d1wena_: