Lineage for d1wena_ (1wen A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894022Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 894023Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) (S)
  5. 894046Family g.50.1.2: PHD domain [57911] (13 proteins)
  6. 894050Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species)
  7. 894057Species Mouse (Mus musculus) [TaxId:10090] [118335] (2 PDB entries)
    Uniprot Q8C0D7 188-245
  8. 894058Domain d1wena_: 1wen A: [114560]
    Structural genomics target
    complexed with zn

Details for d1wena_

PDB Entry: 1wen (more details)

PDB Description: solution structure of phd domain in ing1-like protein bac25079
PDB Compounds: (A:) inhibitor of growth family, member 4; ING1-like protein

SCOP Domain Sequences for d1wena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wena_ g.50.1.2 (A:) Inhibitor of growth protein 4, Ing4 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcp
rcsqesgpssg

SCOP Domain Coordinates for d1wena_:

Click to download the PDB-style file with coordinates for d1wena_.
(The format of our PDB-style files is described here.)

Timeline for d1wena_: