![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) ![]() core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
![]() | Family a.238.1.3: IMD domain [140703] (1 protein) Pfam PF08397 |
![]() | Protein BAP2/IRSp53 N-terminal domain [140704] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140705] (3 PDB entries) Uniprot Q9UQB8 1-248! Uniprot Q9UQB8 2-228 |
![]() | Domain d1wdza1: 1wdz A:2-228 [120928] Other proteins in same PDB: d1wdza2, d1wdzb3 |
PDB Entry: 1wdz (more details), 2.63 Å
SCOPe Domain Sequences for d1wdza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdza1 a.238.1.3 (A:2-228) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} slsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmge lasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalk kyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvsd gyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqq
Timeline for d1wdza1: