Lineage for d1wdza1 (1wdz A:2-228)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
6 helices, homodimer of 3-helical domainsSuperfamily a.238.1: BAR/IMD domain-like [103657] (5 families) 
core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
Family a.238.1.3: IMD domain [140703] (1 protein)
Pfam PF08397Protein BAP2/IRSp53 N-terminal domain [140704] (1 species) Species Human (Homo sapiens) [TaxId:9606] [140705] (3 PDB entries)
Uniprot Q9UQB8 1-248! Uniprot Q9UQB8 2-228
Domain d1wdza1: 1wdz A:2-228 [120928]
Other proteins in same PDB: d1wdza2, d1wdzb3
Details for d1wdza1
PDB Entry: 1wdz (more details), 2.63 Å
PDB Description: Crystal structure of RCB domain of IRSp53
PDB Compounds: (A:) insulin receptor substrate p53SCOPe Domain Sequences for d1wdza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdza1 a.238.1.3 (A:2-228) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
slsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmge
lasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalk
kyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvsd
gyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqq
SCOPe Domain Coordinates for d1wdza1:
Click to download the PDB-style file with coordinates for d1wdza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wdza1:
- d1wdza1 first appeared in SCOP 1.73
- d1wdza1 appears in SCOPe 2.06
- d1wdza1 appears in the current release, SCOPe 2.08
View in 3D
